PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_13894_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 353aa    MW: 40326.8 Da    PI: 7.251
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_13894_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85e-1861108148
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                           rg+WT eEd ll++++  +G g+W++ a++ g++Rt+k+c++rw++yl
  cra_locus_13894_iso_3_len_1238_ver_3  61 RGPWTLEEDNLLIQYISCHGEGRWNKLAKCAGLKRTGKSCRLRWLNYL 108
                                           89********************************************97 PP

2Myb_DNA-binding52.31.3e-16114157146
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                           rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  cra_locus_13894_iso_3_len_1238_ver_3 114 RGNLTPQEQLLILELHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 157
                                           7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.7256108IPR017930Myb domain
SuperFamilySSF466891.56E-3158155IPR009057Homeodomain-like
SMARTSM007171.8E-1560110IPR001005SANT/Myb domain
PfamPF002491.1E-1661108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-2462115IPR009057Homeodomain-like
CDDcd001671.23E-1163108No hitNo description
PROSITE profilePS5129425.751109163IPR017930Myb domain
SMARTSM007172.7E-15113161IPR001005SANT/Myb domain
PfamPF002491.3E-15114157IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-23116162IPR009057Homeodomain-like
CDDcd001674.78E-11118157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
RPGDSSALCT IGSNHLNFLS LKLSQYYSSK IPTMHNKGFS RNVDSNGNAN EEDSTTVDLR  60
RGPWTLEEDN LLIQYISCHG EGRWNKLAKC AGLKRTGKSC RLRWLNYLKP DIKRGNLTPQ  120
EQLLILELHS KWGNRWSKIA QHLPGRTDNE IKNYWRTRVQ KQARQLNIDS NSRKFLEAIR  180
RYWMPRLLEK VDQNSSLSSS SNSSSNNFSS NSSTENLDHF TAPAPSLLKT HQTSNLQSSI  240
SPNSIKFAET SQSLMTNSNM GSSNSPRKTQ LTAEIVENQT TPVQTYGYND ANKVNSALIQ  300
EEEFSHYHPE MSELFESECQ IEETDWFDDE ISAATLWNMD EFWCFRKPAE AGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-255816324128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626235.11e-103PREDICTED: transcription factor MYB108-like
TrEMBLA0A068TWL81e-104A0A068TWL8_COFCA; Uncharacterized protein
STRINGSolyc05g009230.1.15e-99(Solanum lycopersicum)